| Primary information |
|---|
| ID | 12631 |
| Uniprot ID | P19883 |
| Description | Follistatin (FS) (Activin-binding protein) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Isoform 1 is the predominant isoform in serum but is undetectable in follicular fluid. In the embryo; strong expression is seen in the palatal epithelia; including the medial edge epithelial and midli |
| Post Translational Modification | NA |
| Function | Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH). |
| Length | 344 |
| Molecular Weight | 38 |
| Name | Follistatin |
| Sequence | NCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW |
| Sequence map | 35-44 |
| PDB ID | 2B0U; 2P6A; 3HH2; 5JHW; |
| Drugpedia | DB01666; |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|