| Primary information |
|---|
| ID | 12629 |
| Uniprot ID | P24090 |
| Description | Alpha-2-HS-glycoprotein (59 kDa bone sialic acid-containing protein) (BSP) (Fetuin-A) (Glycoprotein PP63) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the fetuin family. |
| Tissue Specificity | Synthesized in liver and secreted by the hepatocytes in the blood. |
| Post Translational Modification | Undergoes complex post-translational modification involving N-glycosylation; and addition of fucose and sialic acid residues. Phosphorylation occurs at a serine residue.; Phosphorylated by FAM20C in t |
| Function | Could inhibit both insulin-receptor tyrosine kinase activity and insulin-stimulated receptor autophosphorylation and; concomitantly; antagonize the mitogenic effect of the hormone in cultured rat hepatoma cells. |
| Length | 352 |
| Molecular Weight | 37 |
| Name | Alpha-2-HS-glycoprotein |
| Sequence | PQGAGLGFRELACDDPETEHVALIAVDYLNKHLLQGFRQILNQIDKVKVWSRRPFGEVYELEIDTLETTCHALDPTPLANCSVRQQAEHAVEGDCDFHILKQDGQFRVLHAQCHSTPDSAEDVRKFCPRCPILIRFNDTNVVHTVKTALAAFNAQNNGTYFKLVEISRAQNVPFPVSTLVEFVIAATDCTGQEVTDPAKCNLLAEKQYGFCKATLIHRLGGEEVSVACKLFQTQPQPANANPAGPAPTVGQAAPVAPPAGPPESVVVGPVAVPLGLPDHRTHHDLRHAFSPVASVESASGEVLHSPKVGQPGDAGAAGPVAPLCPGRVRYFKI |
| Sequence map | 24-52 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|