| Primary information |
|---|
| ID | 12626 |
| Uniprot ID | Q3S2X5 |
| Description | Choriogonadotropin subunit beta (CG-beta) (Chorionic gonadotrophin chain beta) |
| Organism | Saimiri boliviensis boliviensis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Platyrrhini (New World monkeys); Cebidae; Saimiriinae; Saimiri (squirrel monkeys); Saimiri boliviensis (Bolivian squirrel monkey); Saimiri boliviensis boliviensis (Bolivian squirrel |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. |
| Length | 163 |
| Molecular Weight | 17 |
| Name | Choriogonadotropin subunit beta |
| Sequence | KEPLRPPCRPTNVILAVEKEGCPVCVPFNTTICAGYCSSMVRVMQTLPPLPQTVCNYHELRFTSVRLPGCRRGVDPVVYMPMAVSCRCALCRRSYSDCGSFRNESLGCDYATSQDSSSNVPPSNLTSPSQLLEPAVTPLVPQ |
| Sequence map | 23-43 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|