Primary information |
---|
ID | 12625 |
Uniprot ID | P07434 |
Description | Choriogonadotropin subunit beta (CG-beta) (Chorionic gonadotrophin chain beta) |
Organism | Papio anubis |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Papio (baboons); Papio anubis (Olive baboon) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | Placenta. |
Post Translational Modification | NA |
Function | Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. |
Length | 165 |
Molecular Weight | 17 |
Name | Choriogonadotropin subunit beta |
Sequence | REPLRPLCRPINATLAAEKEACPVCVTVNTTICAGYCPTMMRVLQAVLPPVPQVVCNYREVRFESIRLPGCPPGVDPMVSVPVALSCRCALCRRSTSDCGGPKDHPLTCDDPNLQASSSSKDPPPSPPSPSRLLEPAGTPFLPQ |
Sequence map | 23-45 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|