| Primary information |
|---|
| ID | 12620 |
| Uniprot ID | Q9YGH2 |
| Description | Gonadotropin subunit beta-2 (GTH-II-beta) (Gonadotropin beta-II chain) |
| Organism | Clupea pallasii |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Clupei; Clupeiformes (herrings and anchovies); Clupeoidei; Clupeidae (herrings); Clupeinae; Clupea; Clupea pallasii (Pacific herring) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in gametogenesis and steroidogenesis. |
| Length | 149 |
| Molecular Weight | 16 |
| Name | Gonadotropin subunit beta-2 |
| Sequence | NLQPCVLVNETVSVEKEGCPRCLVFRTTICSGHCPTKEPVYKSPFSVVNQHVCTYGNFRYETIRLPDCADGVDPLVTYPVALSCECSLCSMDTSDCTIESVEPDFCMSQRLPVYESQKPSLYDY |
| Sequence map | 27-29 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|