| Primary information |
|---|
| ID | 12615 |
| Uniprot ID | Q14213 |
| Description | Interleukin-27 subunit beta (IL-27 subunit beta) (IL-27B) (Epstein-Barr virus-induced gene 3 protein) (EBV-induced gene 3 protein) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the type I cytokine receptor family. Type 3 subfamily. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Associates with IL27 to form the IL-27 interleukin; a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties; that can regulate T-helper cell development; suppress T-cell proliferation; stimulate cytotoxic T-cell activity; induce isotype switching in B-cells; and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1); type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells; binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines. |
| Length | 229 |
| Molecular Weight | 25 |
| Name | Interleukin-27 subunit beta |
| Sequence | KGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
| Sequence map | 24-49 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q6UWB1 |
| Domain | NA |
| Pharmaceutical Use | NA
|