| Primary information |
|---|
| ID | 12609 |
| Uniprot ID | P56174 |
| Description | Probable insulin-like peptide beta-type 5 |
| Organism | Caenorhabditis elegans |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Nematoda (roundworms); Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis; Caenorhabditis elegans |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Expressed by ASI and ASJ sensory neurons. |
| Post Translational Modification | May be processed by serine endoprotease bli-4. |
| Function | Probable insulin-like peptide which negatively regulates synapse development at the neuromuscular junctions |
| Length | 112 |
| Molecular Weight | 12 |
| Name | Probable insulin-like peptide beta-type 5 |
| Sequence | PAPGETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP |
| Sequence map | 60-52 |
| PDB ID | 2KJI; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|