| Primary information |
|---|
| ID | 12602 |
| Uniprot ID | P43137 |
| Description | Lithostathine-1 (Islet of Langerhans regenerating protein 1) (REG 1) (Pancreatic stone protein 1) (PSP) (Pancreatic thread protein 1) (PTP) (Regenerating protein 1) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed only in regenerating islets and normal exocrine pancreas; but not in normal pancreatic islets. Expressed strongly in pancreas; moderately in gall bladder; and weakly in liver. |
| Post Translational Modification | NA |
| Function | Might act as an inhibitor of spontaneous calcium carbonate precipitation. |
| Length | 165 |
| Molecular Weight | 18 |
| Name | Lithostathine-1 |
| Sequence | EAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG |
| Sequence map | 24-45 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|