| Primary information |
|---|
| ID | 12594 |
| Uniprot ID | P84809 |
| Description | Lipolysis-activating peptide 1-beta chain (BotLVP1-beta) (LVP1-beta) |
| Organism | Buthus occitanus tunetanus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Chelicerata; Arachnida; Scorpiones; Buthida; Buthoidea; Buthidae; Buthus; Buthus occitanus (Common European scorpion); Buthus occitanus tunetanus (Common European scorpion) (Buthus tunetanus) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the long (3 C-C) scorpion toxin superfamily. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | The homodimer inhibits HMG-CoA reductase (HMGCR) (32% of inhibition produced by 0.6 uM); a glycoprotein involved in the control of cholesterol biosynthesis. The inhibitory effects of bumarsin are seen at much lower concentrations (0.6 uM) than that for statins such as atorvastatin (5 mM) and simvastatin (10 uM). In addition to inhibition of HMG-CoA reductase; this protein lowers cholesterol levels by inducing steroid hormone synthesis via StAR; and by increasing reverse cholesterol transport mediated by the induction of ABCA1 and APOA1. |
| Length | 95 |
| Molecular Weight | 10 |
| Name | Lipolysis-activating peptide 1-beta chain |
| Sequence | NVFPNRELGILYGCKGYGNAFCDKVCKMHLARGGGRCGEPNPVMWACECIDIDEDNGYFLNALEKQCPLLKG |
| Sequence map | 24-35 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|