| Primary information |
|---|
| ID | 12587 |
| Uniprot ID | P28172 |
| Description | Interferon tau (IFN-tau) (Antiluteolysin) (Trophoblast antiluteolytic protein) (Trophoblast protein 1) (TP-1) (Trophoblastin) |
| Organism | Ovibos moschatus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Caprinae; Ovibos; Ovibos moschatus (Muskox) |
| Subcellular Location | Secreted Note=Secreted into the uterine lumen. |
| Developmental Stage | Major secretory product synthesized by the conceptus during a very short period in early pregnancy. |
| Similarity | Belongs to the alpha/beta interferon family. IFN-alphaII subfamily. |
| Tissue Specificity | Constitutively and exclusively expressed in the mononuclear cells of the extraembryonic trophectoderm. |
| Post Translational Modification | NA |
| Function | Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors; probably type I interferon receptors; and blocks estrogen receptor expression; preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha; hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This; and a possible direct effect of IFN-tau on prostaglandin synthesis; leads in turn to continued ovarian progesterone secretion; which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary; displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity; high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs; IFN-tau is not virally induc |
| Length | 195 |
| Molecular Weight | 22 |
| Name | Interferon tau |
| Sequence | YLSRRPTLDVRENLRLLDRMNRLSPHSCQQDRKDFGLPQEMVEGDQLQKDQALSVLYEMLQQRFNLFHTEHSCAAWNTTLLEQLRTGLHQQLEDLDTCRGPVMGEKDSELGKMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTSSTTLQKRLKKTGGDLNSP |
| Sequence map | 27-15 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|