Primary information |
---|
ID | 12581 |
Uniprot ID | Q08070 |
Description | Interferon tau-9 (IFN-tau-9) (Antiluteolysin) (TP-010) (Trophoblast antiluteolytic protein) (Trophoblast protein 1) (TP-1) (Trophoblastin) |
Organism | Ovis aries |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Caprinae; Ovis; Ovis aries (Sheep) |
Subcellular Location | Secreted Note=Secreted into the uterine lumen. |
Developmental Stage | Major secretory product synthesized by the sheep conceptus between days 13 and 21 of pregnancy. |
Similarity | Belongs to the alpha/beta interferon family. IFN-alphaII subfamily. |
Tissue Specificity | Constitutively and exclusively expressed in the mononuclear cells of the extraembryonic trophectoderm. |
Post Translational Modification | NA |
Function | Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors; probably type I interferon receptors; and blocks estrogen receptor expression; preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha; hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This; and a possible direct effect of IFN-tau on prostaglandin synthesis; leads in turn to continued ovarian progesterone secretion; which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary; displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity; high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs; IFN-tau is not virally induc |
Length | 195 |
Molecular Weight | 22 |
Name | Interferon tau-9 |
Sequence | YLSQRLMLDARENLKLLEPMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQTFNLFHTEHSSAAWDTTLLEQLCTGLQQQLEDLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP |
Sequence map | 27-15 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|