| Primary information |
|---|
| ID | 12560 |
| Uniprot ID | Q09626 |
| Description | Probable insulin-like peptide beta-type 1 |
| Organism | Caenorhabditis elegans |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Nematoda (roundworms); Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis; Caenorhabditis elegans |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Expressed by ASI and ASJ sensory neurons and weakly by ventral cord motor neurons. |
| Post Translational Modification | NA |
| Function | Probable insulin-like peptide which negatively regulates synapse development at the neuromuscular junctions |
| Length | 106 |
| Molecular Weight | 11 |
| Name | Probable insulin-like peptide beta-type 1 |
| Sequence | PAGEVRACGRRLLLFVWSTCGEPCTPQEDMDIATVCCTTQCTPSYIKQACCPEK |
| Sequence map | 53-46 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|