| Primary information |
|---|
| ID | 12551 |
| Uniprot ID | P08494 |
| Description | Matrix Gla protein (MGP) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the osteocalcin/matrix Gla protein family. |
| Tissue Specificity | NA |
| Post Translational Modification | Requires vitamin K-dependent gamma-carboxylation for its function. |
| Function | Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation. |
| Length | 103 |
| Molecular Weight | 12 |
| Name | Matrix Gla protein |
| Sequence | ESHESMESYEVSPFTTRRNANTFISPQQRWHAKAQERVRELNKPAQEINREACDDYKLCERYALIYGYNAAYNRYFRQRRGAK |
| Sequence map | 21-43 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|