Primary information |
---|
ID | 12551 |
Uniprot ID | P08494 |
Description | Matrix Gla protein (MGP) |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the osteocalcin/matrix Gla protein family. |
Tissue Specificity | NA |
Post Translational Modification | Requires vitamin K-dependent gamma-carboxylation for its function. |
Function | Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation. |
Length | 103 |
Molecular Weight | 12 |
Name | Matrix Gla protein |
Sequence | ESHESMESYEVSPFTTRRNANTFISPQQRWHAKAQERVRELNKPAQEINREACDDYKLCERYALIYGYNAAYNRYFRQRRGAK |
Sequence map | 21-43 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|