Primary information |
---|
ID | 12547 |
Uniprot ID | P58166 |
Description | Inhibin beta E chain (Activin beta-E chain) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the TGF-beta family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Inhibins and activins inhibit and activate; respectively; the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion; gonadal hormone secretion; germ cell development and maturation; erythroid differentiation; insulin secretion; nerve cell survival; embryonic axial development or bone growth; depending on their subunit composition. Inhibins appear to oppose the functions of activins. |
Length | 350 |
Molecular Weight | 38 |
Name | Inhibin beta E chain |
Sequence | PTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
Sequence map | 242-50 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|