| Primary information |
|---|
| ID | 12539 |
| Uniprot ID | Q9R1S9 |
| Description | Midkine (MK) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | In the cortices of the adrenal glands; expressed at 12.5 dpc; decreases considerably at 15.5 dpc and is almost undetectable in the newborn stage. In brain; expressed at low levels in early embryos; ex |
| Similarity | Belongs to the pleiotrophin family. |
| Tissue Specificity | Expressed at a low level in arteries; and at higher levels in newly formed neointima. In brain; expressed in the caudate nucleus and the brain stem. |
| Post Translational Modification | NA |
| Function | Developmentally regulated; secreted growth factor homologous to pleiotrophin (PTN); which has heparin binding activity. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1); followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase; and the induction of cell proliferation. Involved in neointima formation after arterial injury; possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development. |
| Length | 140 |
| Molecular Weight | 15 |
| Name | Midkine |
| Sequence | AKKKDKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRIHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKAKAKKGKGKD |
| Sequence map | 23-20 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|