| Primary information |
|---|
| ID | 12536 |
| Uniprot ID | P04823 |
| Description | Interleukin-3 (IL-3) (Hematopoietic growth factor) (Mast cell growth factor) (MCGF) (Multipotential colony-stimulating factor) (P-cell-stimulating factor) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the IL-3 family. |
| Tissue Specificity | Activated T-cells; mast cells; natural killer cells. |
| Post Translational Modification | NA |
| Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production; differentiation; and function of 2 related white cell populations of the blood; the granulocytes and the monocytes-macrophages.; This CSF induces granulocytes; macrophages; mast cells; stem cells; erythroid cells; eosinophils and megakaryocytes. |
| Length | 166 |
| Molecular Weight | 18 |
| Name | Interleukin-3 |
| Sequence | DRGSDAHHLLRTLDCRTIALEILVKLPVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC |
| Sequence map | 30-46 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|