| Primary information |
|---|
| ID | 12533 |
| Uniprot ID | P26583 |
| Description | High mobility group protein B2 (High mobility group protein 2) (HMG-2) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Nucleus |
| Developmental Stage | NA |
| Similarity | Belongs to the HMGB family. |
| Tissue Specificity | Expressed in gastric and intestinal tissues (at protein level). |
| Post Translational Modification | Reduction/oxidation of cysteine residues Cys-23; Cys-45 and Cys-106 and a possible intramolecular disulfide bond involving Cys-23 and Cys-45 give rise to different redox forms with specific functional |
| Function | Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription; chromatin remodeling and V(D)J recombination and probably other processes. Binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity |
| Length | 209 |
| Molecular Weight | 24 |
| Name | High mobility group protein B2 |
| Sequence | GKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE |
| Sequence map | 4-29 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Both; HMG box 1 and HMG box 2; show antimicrobial |
| Pharmaceutical Use | NA
|