| Primary information |
|---|
| ID | 12512 |
| Uniprot ID | Q9PW99 |
| Description | Gonadotropin subunit beta-1 (GTH-I-beta) (Gonadotropin beta-I chain) |
| Organism | Trichopodus trichopterus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Neoteleostei; Eurypterygia; Ctenosquamata; Acanthomorphata; Euacanthomorphacea; Percomorphaceae; Anabantaria; Anabantiformes (gouramies and others); Anabantoidei; Osphronemidae; Luciocephalinae; Trichopodus; Trichopodus trichopt |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in gametogenesis and steroidogenesis. |
| Length | 118 |
| Molecular Weight | 12 |
| Name | Gonadotropin subunit beta-1 |
| Sequence | RFGCHLTNISFPVDSCGITEFIYTTICAGHCYHEDPVYIGHDDWAEQKICNGDWTYEVKHLQGCPVAVTYPVARNCECTACNAGNTYCGHFHGYIPSCL |
| Sequence map | 20-58 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|