| Primary information |
|---|
| ID | 12509 |
| Uniprot ID | Q9Z0J7 |
| Description | Growth/differentiation factor 15 (GDF-15) (Macrophage inhibitory cytokine 1) (MIC-1) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | At postnatal day 3 (P3); detected in heart and plasma; expression decreases with lower levels at P7 to; at least; P13. |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | Highly expressed in liver (PubMed-10779363; PubMed-28572090; PubMed-29046435). Detected in plasma (at protein level) (PubMed-28572090; PubMed-29046435). Expressed by cardiomyocytes; expression is high |
| Post Translational Modification | NA |
| Function | Regulates food intake; energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor; GFRAL; and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala; which constitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions |
| Length | 303 |
| Molecular Weight | 33 |
| Name | Growth/differentiation factor 15 |
| Sequence | AHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA |
| Sequence map | 194-03 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|