| Primary information |
|---|
| ID | 12507 |
| Uniprot ID | Q5IGQ0 |
| Description | Erythropoietin |
| Organism | Epinephelus coioides |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Neoteleostei; Eurypterygia; Ctenosquamata; Acanthomorphata; Euacanthomorphacea; Percomorphaceae; Eupercaria; Perciformes (perches and others); Serranoidei; Serranidae (sea basses); Epinephelinae; Epinephelini; Epinephelus; Epine |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the EPO/TPO family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. |
| Length | 185 |
| Molecular Weight | 20 |
| Name | Erythropoietin |
| Sequence | LLSPLRPICDLRVLNHFIKEARDAEVAMKSCTEGCSLSESVTVPQTRVDFDVWEKKNGLEQAQEVQSGLWLLQQALNLLRTSVTNTALHSHIDNSIRNLLSINAVLRSLNIQEYTPPASTVALEGTWRVSSATDLLQVHVNFLRGKVRLLLLDAQACQQDVS |
| Sequence map | 26-05 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|