Primary information |
---|
ID | 12507 |
Uniprot ID | Q5IGQ0 |
Description | Erythropoietin |
Organism | Epinephelus coioides |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Neoteleostei; Eurypterygia; Ctenosquamata; Acanthomorphata; Euacanthomorphacea; Percomorphaceae; Eupercaria; Perciformes (perches and others); Serranoidei; Serranidae (sea basses); Epinephelinae; Epinephelini; Epinephelus; Epine |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the EPO/TPO family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. |
Length | 185 |
Molecular Weight | 20 |
Name | Erythropoietin |
Sequence | LLSPLRPICDLRVLNHFIKEARDAEVAMKSCTEGCSLSESVTVPQTRVDFDVWEKKNGLEQAQEVQSGLWLLQQALNLLRTSVTNTALHSHIDNSIRNLLSINAVLRSLNIQEYTPPASTVALEGTWRVSSATDLLQVHVNFLRGKVRLLLLDAQACQQDVS |
Sequence map | 26-05 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|