Primary information |
---|
ID | 12506 |
Uniprot ID | Q2XNF5 |
Description | Erythropoietin (Erythropoietin-L2) |
Organism | Danio rerio |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the EPO/TPO family. |
Tissue Specificity | Expressed in heart and liver. |
Post Translational Modification | N-glycosylated. |
Function | Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. |
Length | 183 |
Molecular Weight | 20 |
Name | Erythropoietin |
Sequence | PLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS |
Sequence map | 27-03 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|