Primary information |
---|
ID | 12501 |
Uniprot ID | Q03288 |
Description | Agouti-signaling protein (ASP) (Agouti coat color protein) (Agouti switch protein) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | Widely expressed in embryonic and neonatal skin. |
Similarity | NA |
Tissue Specificity | Epithelial cells of the hair follicles and the epidermis. |
Post Translational Modification | NA |
Function | Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP; leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). Causes hair follicle melanocytes to synthesize phaeomelanin instead of black or brown pigment eumelanin and produces hairs with a subapical yellow band on an otherwise black or brown background when expressed during the mid-portion of hair growth. |
Length | 131 |
Molecular Weight | 14 |
Name | Agouti-signaling protein |
Sequence | LALEETLGDDRSLRSNSSMNSLDFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAPACCDPCASCQCRFFGSACTCRVLNPNC |
Sequence map | 25-11 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | The presence of a 'disulfide through disulfide kno |
Pharmaceutical Use | NA
|