Primary information |
---|
ID | 12499 |
Uniprot ID | Q6UXH0 |
Description | Angiopoietin-like protein 8 (Betatrophin) (Lipasin) (Refeeding-induced fat and liver protein) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | Transcripts are up-regulated by 100 fold during adipogenesis. |
Similarity | Belongs to the ANGPTL8 family. |
Tissue Specificity | Predominantly expressed in liver. Also expressed in adipose tissues. |
Post Translational Modification | Proteolytically cleaved at the N-terminus. |
Function | Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels |
Length | 198 |
Molecular Weight | 22 |
Name | Angiopoietin-like protein 8 |
Sequence | PMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA |
Sequence map | 25-18 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|