| Primary information |
|---|
| ID | 12499 |
| Uniprot ID | Q6UXH0 |
| Description | Angiopoietin-like protein 8 (Betatrophin) (Lipasin) (Refeeding-induced fat and liver protein) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | Transcripts are up-regulated by 100 fold during adipogenesis. |
| Similarity | Belongs to the ANGPTL8 family. |
| Tissue Specificity | Predominantly expressed in liver. Also expressed in adipose tissues. |
| Post Translational Modification | Proteolytically cleaved at the N-terminus. |
| Function | Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels |
| Length | 198 |
| Molecular Weight | 22 |
| Name | Angiopoietin-like protein 8 |
| Sequence | PMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA |
| Sequence map | 25-18 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|