| Primary information |
|---|
| ID | 12491 |
| Uniprot ID | P19313 |
| Description | Cystatin-S (Cystatin-1) (Protein LM) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the cystatin family. |
| Tissue Specificity | Found in saliva; tears; urine and seminal fluid. |
| Post Translational Modification | NA |
| Function | This protein strongly inhibits papain and ficin; partially inhibits stem bromelain and bovine cathepsin C; but does not inhibit porcine cathepsin B or clostripain. Papain is inhibited non-competitively. |
| Length | 141 |
| Molecular Weight | 15 |
| Name | Cystatin-S |
| Sequence | HFLGGIEKSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSFVVHDIPWENYIVLLSSSCHSI |
| Sequence map | 30-21 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|