Primary information |
---|
ID | 12490 |
Uniprot ID | Q3HRV3 |
Description | Choriogonadotropin subunit beta (CG-beta) (Chorionic gonadotrophin chain beta) |
Organism | Aotus nancymaae |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Platyrrhini (New World monkeys); Aotidae; Aotus (night monkeys); Aotus nancymaae (Ma's night monkey) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. |
Length | 164 |
Molecular Weight | 17 |
Name | Choriogonadotropin subunit beta |
Sequence | NEPLRPLCRPTHAILAAEKEGCPVCVAFNTTICAGYCSSMVRVLQTVMPPLPQLVCNYHELRFTSVRLPGCRRGVNPVVYFPVAVSCRCALCRRSYSDCGNLKSEPLGCDYHTSQDSSSKDPPRNLTSPSQLPEPADAPLVPQ |
Sequence map | 23-44 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|