| Primary information |
|---|
| ID | 12475 |
| Uniprot ID | Q9TU18 |
| Description | Agouti-related protein |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R. Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner. |
| Length | 134 |
| Molecular Weight | 14 |
| Name | Agouti-related protein |
| Sequence | PRRCVRLHESCLGHQVPCCDPCATCYCRFFNAFCYCRKLGTATNPCSRT |
| Sequence map | 87-14 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The presence of a 'disulfide through disulfide kno |
| Pharmaceutical Use | NA
|