| Primary information |
|---|
| ID | 12453 |
| Uniprot ID | P10762 |
| Description | Apolipophorin-3b (Apolipophorin-IIIb) (ApoLp-IIIb) |
| Organism | Locusta migratoria |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Polyneoptera; Orthoptera; Caelifera (grasshoppers and locusts); Acrididea; Acridomorpha; Acridoidea; Acrididae (short-horned grasshoppers); Oedipodinae (band-winged grasshoppers); Locusta; Locusta migratoria (Migratory locust) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insect apolipophorin-3 family. |
| Tissue Specificity | Hemolymph. |
| Post Translational Modification | NA |
| Function | Assists in the loading of diacylglycerol; generated from triacylglycerol stores in the fat body through the action of adipokinetic hormone; into lipophorin; the hemolymph lipoprotein. It increases the lipid carrying capacity of lipophorin by covering the expanding hydrophobic surface resulting from diacylglycerol uptake. It thus plays a critical role in the transport of lipids during flight in several species of insects. |
| Length | 179 |
| Molecular Weight | 19 |
| Name | Apolipophorin-3b |
| Sequence | PDAAGHVNIAEAVQQLNHTIVNAAHELHETLGLPTPDEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNRFARNLNNSIHDAATSAQPADQLNSLQSALTNVGHQWQTSQPRPSVAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQKPAN |
| Sequence map | 19-59 |
| PDB ID | 1AEP; 1LS4; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|