| Primary information |
|---|
| ID | 12450 |
| Uniprot ID | Q9Z0J6 |
| Description | Growth/differentiation factor 15 (GDF-15) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | Detected in plasma (at protein level). |
| Post Translational Modification | NA |
| Function | Regulates food intake; energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor; GFRAL; and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala; which constitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions (Probable). On hepatocytes; inhibits growth hormone signaling. |
| Length | 303 |
| Molecular Weight | 33 |
| Name | Growth/differentiation factor 15 |
| Sequence | AHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA |
| Sequence map | 194-03 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|