| Primary information |
|---|
| ID | 12443 |
| Uniprot ID | P18418 |
| Description | Calreticulin (CALBP) (CRP55) (Calcium-binding protein 3) (CABP3) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Endoplasmic reticulum lumen |
| Developmental Stage | NA |
| Similarity | Belongs to the calreticulin family. |
| Tissue Specificity | Predentin and odontoblast. |
| Post Translational Modification | NA |
| Function | Calcium-binding chaperone that promotes folding; oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. Present in the cortical granules of non-activated oocytes; is exocytosed during the cortical reaction in response to oocyte activation and might participate in the block to polyspermy. |
| Length | 416 |
| Molecular Weight | 47 |
| Name | Calreticulin |
| Sequence | PAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEDEEDEKEEDEEDATGQAKDEL |
| Sequence map | 24-56 |
| PDB ID | 1HHN; 1K91; 1K9C; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Can be divided into a N-terminal globular domain; |
| Pharmaceutical Use | NA
|