| Primary information |
|---|
| ID | 12441 |
| Uniprot ID | P49157 |
| Description | Erythropoietin |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the EPO/TPO family. |
| Tissue Specificity | Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. |
| Post Translational Modification | NA |
| Function | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors; including STAT1 and STAT3. |
| Length | 194 |
| Molecular Weight | 21 |
| Name | Erythropoietin |
| Sequence | PPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR |
| Sequence map | 30-14 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|