| Primary information |
|---|
| ID | 12433 |
| Uniprot ID | P18075 |
| Description | Bone morphogenetic protein 7 (BMP-7) (Osteogenic protein 1) (OP-1) (Eptotermin alfa) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in the developing eye; brain and ear during embryogenesis. |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | Expressed in the kidney and bladder. Lower levels seen in the brain. |
| Post Translational Modification | Several N-termini starting at positions 293; 300; 315 and 316 have been identified by direct sequencing resulting in secretion of different mature forms. |
| Function | Growth factor of the TGF-beta superfamily that plays important role in various biological processes; including embryogenesis; hematopoiesis; neurogenesis and skeletal morphogenesis |
| Length | 431 |
| Molecular Weight | 49 |
| Name | Bone morphogenetic protein 7 |
| Sequence | TGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
| Sequence map | 300-11 |
| PDB ID | 1BMP; 1LX5; 1LXI; 1M4U; |
| Drugpedia | NA |
| Receptor | Q13873 |
| Domain | NA |
| Pharmaceutical Use | Available under the name Osigraft (Stryker). Its use is indicated in the treatment of tibial non-union of at least 9 months duration; secondary to trauma; in skeletally mature patients; in cases where |