| Primary information |
|---|
| ID | 12430 |
| Uniprot ID | A1YL70 |
| Description | Agouti-signaling protein (ASP) (Agouti switch protein) |
| Organism | Papio anubis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Papio (baboons); Papio anubis (Olive baboon) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP; leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). |
| Length | 132 |
| Molecular Weight | 14 |
| Name | Agouti-signaling protein |
| Sequence | LPPEEKLRDDRSLRSNSSVNLLDFPSVSIVALNKKSKQISRKEAEKKRSSKKEASMKKVARPRTPLSAPCVATRDSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC |
| Sequence map | 25-12 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The presence of a 'disulfide through disulfide kno |
| Pharmaceutical Use | NA
|