| Primary information |
|---|
| ID | 12427 |
| Uniprot ID | P12837 |
| Description | Gonadotropin subunit beta (Gonadotropin beta chain) |
| Organism | Muraenesox cinereus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Elopocephalai; Elopocephala; Elopomorpha; Anguilliformes (true eels); Muraenesocidae (pike congers); Muraenesox; Muraenesox cinereus (Daggertooth pike conger) (Muraena cinerea) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in gametogenesis and steroidogenesis. |
| Length | 113 |
| Molecular Weight | 12 |
| Name | Gonadotropin subunit beta |
| Sequence | VLQPCQPINETISVEKDGCPKCLVFQTSICSGHCITKDPSYKSPLSTVYQRVCTYRDVRYETVRLPDCRPGVDPHVTFPVALSCDCNLCTMDTSDCAIQSLRPDFCMSQRAP |
| Sequence map | 2-53 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|