| Primary information |
|---|
| ID | 12425 |
| Uniprot ID | Q90844 |
| Description | Follistatin (FS) (Activin-binding protein) |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
| Subcellular Location | Secreted |
| Developmental Stage | Levels increase in the iris from embryonic day 9 (E9) to E16 in contrast to the choroid where it remains low relative to iris. During early hindbrain development strongly expressed in rhombomeres R2; |
| Similarity | NA |
| Tissue Specificity | Ciliary ganglion neurons. Levels are higher in the iris than the choroid. |
| Post Translational Modification | NA |
| Function | Binds directly to activin and functions as an activin antagonist. Inhibits activin A signaling in the iris and regulates somatostatin phenotype in ciliary ganglion neurons. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH). |
| Length | 343 |
| Molecular Weight | 38 |
| Name | Follistatin |
| Sequence | NCWLRQARNGRCQVLYKTDLSKEECCKSGRLTTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCKMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVLCPGSSTCVVDQTNNAYCVTCNRICPEPTSPEQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCSAGKKCLWDFKVGRGRCALCDELCPESKSDEAVCASDNTTYPSECAMKEAACSMGVLLEVKHSGSCNSINEDPEEEEEDEDQDYSFPISSILEW |
| Sequence map | 34-43 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|