| Primary information |
|---|
| ID | 12416 |
| Uniprot ID | P12644 |
| Description | Bone morphogenetic protein 4 (BMP-4) (Bone morphogenetic protein 2B) (BMP-2B) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted; extracellular space; extracellular matrix. |
| Developmental Stage | NA |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues; and prostate cancer cell lines. |
| Post Translational Modification | NA |
| Function | Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes; including neurogenesis; vascular development; angiogenesis and osteogenesis |
| Length | 408 |
| Molecular Weight | 46 |
| Name | Bone morphogenetic protein 4 |
| Sequence | PKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Sequence map | 299-48 |
| PDB ID | NA |
| Drugpedia | DB01373; |
| Receptor | P36894; Q13873 |
| Domain | NA |
| Pharmaceutical Use | NA
|