| Primary information |
|---|
| ID | 12409 |
| Uniprot ID | A0A0F7Z3J2 |
| Description | Thyrostimulin alpha-2 subunit |
| Organism | Conus victoriae |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Conidae (cone shells); Conus; Cylinder; Conus victoriae (Queen Victoria cone) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | Expressed by the venom duct. |
| Post Translational Modification | NA |
| Function | NA |
| Length | 144 |
| Molecular Weight | 15 |
| Name | Thyrostimulin alpha-2 subunit |
| Sequence | KRHSWEAPGCHLVGHTRVVRIPDCVPFQITTNACRGFCVSYAIPSPYQTLVYNPNHIITSRAACCDIIDTLDIPVQVTCVDGVREIVFKSARSCACSICRRE |
| Sequence map | 44-24 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|