Primary information |
---|
ID | 12398 |
Uniprot ID | A1YL78 |
Description | Agouti-signaling protein (ASP) (Agouti switch protein) |
Organism | Callithrix geoffroyi |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Platyrrhini (New World monkeys); Cebidae; Callitrichinae (marmosets and tamarins); Callithrix; Callithrix; Callithrix geoffroyi (Geoffroy's marmoset) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP; leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). |
Length | 132 |
Molecular Weight | 14 |
Name | Agouti-signaling protein |
Sequence | LPPEEKLRDDRSLRSNSSVNLLDLPSVSIVALNKKSKKISRKEAEKKRSSKKEASKQKVARPRTPLSVPCVSTRGSCKPPAPACCHPCASCQCRFFRSACSCRVLNVNC |
Sequence map | 25-12 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | The presence of a 'disulfide through disulfide kno |
Pharmaceutical Use | NA
|