| Primary information |
|---|
| ID | 12392 |
| Uniprot ID | P46193 |
| Description | Annexin A1 (Annexin I) (Annexin-1) (Calpactin II) (Calpactin-2) (Chromobindin-9) (Lipocortin I) (Phospholipase A2 inhibitory protein) (p35) |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | Nucleus |
| Developmental Stage | NA |
| Similarity | Belongs to the annexin family. |
| Tissue Specificity | Detected on surface epithelia and mucosal glands in nasal cavity; trachea; bronchi and bronchioles. Detected in blood vessel endothelial cells. Detected in neutrophils (at protein level). |
| Post Translational Modification | Phosphorylated by protein kinase C; EGFR and TRPM7. Phosphorylated in response to EGF treatment. |
| Function | Plays important roles in the innate immune response as effector of glucocorticoid-mediated responses and regulator of the inflammatory process. Has anti-inflammatory activity. Plays a role in glucocorticoid-mediated down-regulation of the early phase of the inflammatory response. Promotes resolution of inflammation and wound healing. Functions at least in part by activating the formyl peptide receptors and downstream signaling cascades. Promotes chemotaxis of granulocytes and monocytes via activation of the formyl peptide receptors. Contributes to the adaptive immune response by enhancing signaling cascades that are triggered by T-cell activation; regulates differentiation and proliferation of activated T-cells. Promotes the differentiation of T-cells into Th1 cells and negatively regulates differentiation into Th2 cells. Has no effect on unstimulated T-cells. Promotes rearrangement of the actin cytoskeleton; cell polarization and cell migration. Negatively regulates hormone exocytosis |
| Length | 346 |
| Molecular Weight | 38 |
| Name | Annexin A1 |
| Sequence | MVSEFLKQAWFIENEEQEYIKTVKGSKGGPGSAVSPYPTFNPSSDVEALHKAITVKGVDEATIIEILTKRNNAQRQQIKAAYLQEKGKPLDEVLKKALLGHLEEVVLALLKTPAQFDAEELRAAMKGLGTDEDTLNEILASRTNREIREINRVYREELKRDLAKDIASDTSGDYEKALLSLAKGDRSEELAVNDDLADSDARALYEAGERRKGTDVNVFITILTTRSYPHLRRVFQKYSKYSKHDMNKVLDLELKGDIEKCLTVIVKCATSQPMFFAEKLHQAMKGIGTRHKTLIRIMVSRSEIDMNDIKACYQKLYGISLCQAILDETKGDYEKILVALCGRD |
| Sequence map | 7-46 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The full-length protein can bind eight Ca(2+) ions |
| Pharmaceutical Use | NA
|