| Primary information |
|---|
| ID | 12388 |
| Uniprot ID | O04012 |
| Description | Auxin-binding protein ABP19b |
| Organism | Prunus persica |
| Txonomy | Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Amygdaloideae; Amygdaleae; Prunus; Prunus persica (Peach) (Amygdalus persica) |
| Subcellular Location | Secreted; extracellular space; apoplast. Secreted; cell wall. |
| Developmental Stage | NA |
| Similarity | Belongs to the germin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Probable receptor for the plant growth-promoting hormone auxin. |
| Length | 209 |
| Molecular Weight | 21 |
| Name | Auxin-binding protein ABP19b |
| Sequence | VQDFCVADYKAPDGPAGYSCKKPAIVTVNDFVYSGLGIAGNTTNIFKAAVTPAFAAQFPGVNGLGISLARLDLGPGGVVPFHTHPGASEVLLVVQGTIIAGFVASDNTPYLKTLKKGDIIVFPQGLLHFQVNGGDTPAIAFPSFSSPSPGLQIVDFALFKNDLATELIAQTTLLDAPQIKKLKGVLGGTN |
| Sequence map | 22-29 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|