Primary information |
---|
ID | 12387 |
Uniprot ID | O46576 |
Description | Bone morphogenetic protein 4 (BMP-4) |
Organism | Oryctolagus cuniculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Lagomorpha; Leporidae (rabbits and hares); Oryctolagus; Oryctolagus cuniculus (Rabbit) |
Subcellular Location | Secreted; extracellular space; extracellular matrix |
Developmental Stage | NA |
Similarity | Belongs to the TGF-beta family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes; including neurogenesis; vascular development; angiogenesis and osteogenesis. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface; BMPR2 phosphorylates and activates BMPR1A. In turn; BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK/MAP kinase; PI3K/Akt; or SRC cascades. For example; induces SRC phosphorylation which; in turn; activates VEGFR2; leading to an angiogenic response. |
Length | 409 |
Molecular Weight | 46 |
Name | Bone morphogenetic protein 4 |
Sequence | LKHHPQRARKKNKNCRRHALYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHFNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Sequence map | 300-49 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|