| Primary information |
|---|
| ID | 12386 |
| Uniprot ID | P21275 |
| Description | Bone morphogenetic protein 4 (BMP-4) (Bone morphogenetic protein 2B) (BMP-2B) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted; extracellular space; extracellular matrix. |
| Developmental Stage | NA |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | In the cochlea; detected in nonprosensory regions and outer sulcus (at protein level) (PubMed-32127020). Prior to gastrulation; expressed in the extraembryonic ectoderm. Later; expressed in the extrae |
| Post Translational Modification | NA |
| Function | Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes; including neurogenesis; vascular development; angiogenesis and osteogenesis |
| Length | 408 |
| Molecular Weight | 46 |
| Name | Bone morphogenetic protein 4 |
| Sequence | PKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Sequence map | 299-48 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|