Primary information |
---|
ID | 12385 |
Uniprot ID | Q9R229 |
Description | Bone morphogenetic protein 10 (BMP-10) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | Down-regulation after 14.5 dpc is critical for cardiomyocytes to undergo normal developmental hypertrophic growth in early postnatal life. |
Similarity | Belongs to the TGF-beta family. |
Tissue Specificity | In the embryo; expressed exclusively in the ventricular trabecular myocardium of the developing heart from 9.0 dpc-13.5 dpc. By 16.5 dpc-18.5 dpc; only detectable in atria. Highly expressed in the adu |
Post Translational Modification | NA |
Function | Required for maintaining the proliferative activity of embryonic cardiomyocytes by preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP and maintaining the required expression levels of cardiogenic factors such as MEF2C and NKX2-5. Acts as a ligand for ACVRL1/ALK1; BMPR1A/ALK3 and BMPR1B/ALK6; leading to activation of SMAD1; SMAD5 and SMAD8 transcription factors. Inhibits endothelial cell migration and growth. May reduce cell migration and cell matrix adhesion in breast cancer cell lines. |
Length | 421 |
Molecular Weight | 47 |
Name | Bone morphogenetic protein 10 |
Sequence | AKGNYCKKTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLDPISILYLDKGVVTYKFKYEGMAVSECGCR |
Sequence map | 321-01 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|