| Primary information |
|---|
| ID | 12379 |
| Uniprot ID | Q8MJV5 |
| Description | Bone morphogenetic protein 4 (BMP-4) (sBmp4) |
| Organism | Suncus murinus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Eulipotyphla (hedgehogs; shrews; moles and others); Soricidae (shrews); Crocidurinae; Suncus (musk shrews); Suncus murinus (Asian house shrew) (Musk shrew) |
| Subcellular Location | Secreted; extracellular space; extracellular matrix |
| Developmental Stage | NA |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes; including neurogenesis; vascular development; angiogenesis and osteogenesis. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface; BMPR2 phosphorylates and activates BMPR1A. In turn; BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK/MAP kinase; PI3K/Akt; or SRC cascades. For example; induces SRC phosphorylation which; in turn; activates VEGFR2; leading to an angiogenic response. |
| Length | 409 |
| Molecular Weight | 46 |
| Name | Bone morphogenetic protein 4 |
| Sequence | PKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Sequence map | 300-49 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|