| Primary information |
|---|
| ID | 12378 |
| Uniprot ID | P23359 |
| Description | Bone morphogenetic protein 7 (BMP-7) (Osteogenic protein 1) (OP-1) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Growth factor of the TGF-beta superfamily that plays important role in various biological processes; including embryogenesis; hematopoiesis; neurogenesis and skeletal morphogenesis |
| Length | 430 |
| Molecular Weight | 49 |
| Name | Bone morphogenetic protein 7 |
| Sequence | TGGKQRSQNRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
| Sequence map | 299-10 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|