| Primary information |
|---|
| ID | 12367 |
| Uniprot ID | P48745 |
| Description | CCN family member 3 (Cellular communication network factor 3) (Insulin-like growth factor-binding protein 9) (IBP-9) (IGF-binding protein 9) (IGFBP-9) (Nephro blastoma-overexpressed gene protein homolog) (Protein NOV homolog) (NovH) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted Cytoplasm |
| Developmental Stage | Expressed in primitive compartments of umbilical vein cord. |
| Similarity | Belongs to the CCN family. |
| Tissue Specificity | Expressed in endiothelial cells (at protein level) (PubMed-21063504). Expressed in bone marrow; thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type. |
| Post Translational Modification | May be palmitoylated on Cys-244; which is important for extracellular secretion. |
| Function | Immediate-early protein playing a role in various cellular processes including proliferation; adhesion; migration; differentiation and survival |
| Length | 357 |
| Molecular Weight | 39 |
| Name | CCN family member 3 |
| Sequence | QRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM |
| Sequence map | 37-57 |
| PDB ID | NA |
| Drugpedia | DB00071; |
| Receptor | P46531 |
| Domain | NA |
| Pharmaceutical Use | NA
|