| Primary information |
|---|
| ID | 12365 |
| Uniprot ID | O61643 |
| Description | Inhibin beta chain (Activin beta chain) (dAct) (dActivin) |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in embryonic; larval and adult stages. |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | Widely expressed in larval brains. |
| Post Translational Modification | NA |
| Function | Controls several aspects of neuronal morphogenesis; essential for optic lobe development; EcR-B1 expression in larval brains; mushroom body remodeling; dorsal neuron morphogenesis and motoneuron axon guidance. Ligands Actbeta and daw act redundantly through the Activin receptor Babo and its transcriptional mediator Smad2 (Smox); to regulate neuroblast numbers and proliferation rates in the developing larval brain. |
| Length | 946 |
| Molecular Weight | 108 |
| Name | Inhibin beta chain |
| Sequence | VDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGIIKRDLPKMVVDECGCP |
| Sequence map | 849-46 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|