Primary information |
---|
ID | 12353 |
Uniprot ID | Q90326 |
Description | Insulin-like growth factor I; juvenile form |
Organism | Cyprinus carpio |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Cyprinidae; Cyprininae; Cyprinus; Cyprinus carpio (Common carp) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the insulin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R; leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. |
Length | 161 |
Molecular Weight | 17 |
Name | Insulin-like growth factor I; juvenile form |
Sequence | PETLCGAELVDTLQFVCGDRGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKPGKTP |
Sequence map | 46-54 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|