Primary information |
---|
ID | 12349 |
Uniprot ID | Q4ZJN1 |
Description | Complement C1q and tumor necrosis factor-related protein 9 |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | Expressed predominantly in adipose tissue. Females express higher levels than males. |
Post Translational Modification | The isomeric forms of the hydroxylated amino acids could not be determined in the mass-spectrometric methods reported in PubMed-18787108 but are assumed on the basis of their occurrence in collagen-li |
Function | Probable adipokine. Activates AMPK; AKT; and p44/42 MAPK signaling pathways. |
Length | 333 |
Molecular Weight | 34 |
Name | Complement C1q and tumor necrosis factor-related protein 9 |
Sequence | DTCRQGHSGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGHPGGPGKDGIRGEKGEPGADGRVEAKGIKGDPGSRGSPGKHGPKGSIGPTGEQGLPGETGPQGQKGDKGEVGPTGPEGLMGSTGPLGPKGLPGPMGPIGKPGPRGEAGPMGPQGEPGVRGMRGWKGDRGEKGKVGEAPLVPKSAFTVGLTVISKFPPPDAPIKFDKILYNELNHYNVATGKFTCHVAGVYYFTYHITVFSRNVQVSLVKNGVKVLHTKDSYMSSEDQASGGIVQELKLGDEVWMQVTGGERFNGLFADEDDDTTFTGFLLFSSS |
Sequence map | 25-33 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|