| Primary information |
|---|
| ID | 12334 |
| Uniprot ID | P33622 |
| Description | Apolipoprotein C-III (Apo-CIII) (ApoC-III) (Apolipoprotein C3) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the apolipoprotein C3 family. |
| Tissue Specificity | NA |
| Post Translational Modification | The most abundant glycoforms are characterized by an O-linked disaccharide galactose linked to N-acetylgalactosamine (Gal-GalNAc); further modified with up to 3 sialic acid residues. Less abundant gly |
| Function | Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly; promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly; attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges; so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners. |
| Length | 99 |
| Molecular Weight | 10 |
| Name | Apolipoprotein C-III |
| Sequence | EVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES |
| Sequence map | 22-39 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|