| Primary information |
|---|
| ID | 12327 |
| Uniprot ID | Q91653 |
| Description | Corticotropin-releasing factor-binding protein (CRF-BP) (CRF-binding protein) (Corticotropin-releasing hormone-binding protein) (CRH-BP) |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the CRF-binding protein family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Binds CRF and inactivates it. May prevent inappropriate pituitary-adrenal stimulation in pregnancy. |
| Length | 321 |
| Molecular Weight | 36 |
| Name | Corticotropin-releasing factor-binding protein |
| Sequence | SRYIQMREAAEDALFLLNSDFKRELSEGQIYRRSLRCIDMLSIEGQFTFQADRPQLHCALFLIGEPEEFIIIEYNFVNIDCIGGDILKVFDGWIIKGEKFPSSLDHPLSTMERYTDICEDGDVGSITRSSQNVAMIFFRVQQPGHGFTLTIRKIPNLFPCNVISQSMNGRFTMITPHQHRNCSFSIIYPVVIKIFDLTLGHFNELQLKKPPPKGCGDAGDFVELLGGAGLDPSKMFPLADLCHSFHGSAQMKIGCDNTVVRMVSSGNFINRVTFEYNQLDRQLEKKQGNSVEEACFPSD |
| Sequence map | 27-21 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|